Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone chaperone ASF1A
LigandBDBM50101707
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1462421
IC50 15000±n/a nM
Citation Miknis, GFStevens, SJSmith, LEOstrov, DAChurchill, ME Development of novel Asf1-H3/H4 inhibitors. Bioorg Med Chem Lett25:963-8 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone chaperone ASF1A
Name:Histone chaperone ASF1A
Synonyms:ASF1A | Anti-silencing function protein 1 homolog A | CCG1-interacting factor A | CIA | HSPC146 | Histone chaperone ASF1A | hAsf1 | hAsf1a | hCIA
Type:PROTEIN
Mol. Mass.:22950.75
Organism:Homo sapiens
Description:ChEMBL_109562
Residue:204
Sequence:
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSV
LVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTET
ELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALP
SASKGWSTSENSLNVMLESHMDCM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50101707
NameBDBM50101707
Synonyms:CHEMBL3394904
TypeSmall organic molecule
Emp. Form.C21H17BrN4O4
Mol. Mass.469.288
SMILESCOc1cc(\C=N\NC(=O)c2ccc(NC(=O)c3ccccn3)cc2)cc(Br)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a