Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTau
LigandBDBM50103980
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1505258
Ki 48±n/a nM
Citation Chu, WZhou, DGaba, VLiu, JLi, SPeng, XXu, JDhavale, DBagchi, DPd'Avignon, AShakerdge, NBBacskai, BJTu, ZKotzbauer, PTMach, RH Design, Synthesis, and Characterization of 3-(Benzylidene)indolin-2-one Derivatives as Ligands fora-Synuclein Fibrils. J Med Chem58:6002-17 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tau
Name:Tau
Synonyms:MAPT | MAPTL | MTBT1 | Microtubule-associated protein tau | Neurofibrillary tangle protein | PHF-tau | Paired helical filament-tau | Tau Protein
Type:Protein
Mol. Mass.:78928.63
Organism:Homo sapiens (Human)
Description:P10636
Residue:758
Sequence:
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEG
GRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA
QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPA
AAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK
GQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREP
KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD
LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEK
LDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT
SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50103980
n/a
NameBDBM50103980
Synonyms:CHEMBL3593905
TypeSmall organic molecule
Emp. Form.C19H18N2O2
Mol. Mass.306.3584
SMILESCN(C)c1ccc(\C=C\C=C2/C(=O)Nc3ccc(O)cc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: