Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase N
LigandBDBM50105625
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1507527
Ki 3.0±n/a nM
Citation Revelant, GAl-Lakkis-Wehbe, MSchmitt, MAlavi, SSchmitt, CRoux, LAl-Masri, MSchifano-Faux, NMaiereanu, CTarnus, CAlbrecht, S Exploring S1 plasticity and probing S1' subsite of mammalian aminopeptidase N/CD13 with highly potent and selective aminobenzosuberone inhibitors. Bioorg Med Chem23:3192-207 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase N
Name:Aminopeptidase N
Synonyms:ANPEP | AP-M | AP-N | Alanyl aminopeptidase | Aminopeptidase M | Aminopeptidase N (APN) | CD_antigen=CD13 | Microsomal aminopeptidase | gp130 | pAPN
Type:Protein
Mol. Mass.:108810.25
Organism:Sus scrofa (Pig)
Description:P15145
Residue:963
Sequence:
MAKGFYISKALGILGILLGVAAVATIIALSVVYAQEKNKNAEHVPQAPTSPTITTTAAIT
LDQSKPWNRYRLPTTLLPDSYNVTLRPYLTPNADGLYIFKGKSIVRLLCQEPTDVIIIHS
KKLNYTTQGHMVVLRGVGDSQVPEIDRTELVELTEYLVVHLKGSLQPGHMYEMESEFQGE
LADDLAGFYRSEYMEGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPNNLTA
LSNMPPKGSSTPLAEDPNWSVTEFETTPVMSTYLLAYIVSEFQSVNETAQNGVLIRIWAR
PNAIAEGHGMYALNVTGPILNFFANHYNTSYPLPKSDQIALPDFNAGAMENWGLVTYREN
ALLFDPQSSSISNKERVVTVIAHELAHQWFGNLVTLAWWNDLWLNEGFASYVEYLGADHA
EPTWNLKDLIVPGDVYRVMAVDALASSHPLTTPAEEVNTPAQISEMFDSISYSKGASVIR
MLSNFLTEDLFKEGLASYLHAFAYQNTTYLDLWEHLQKAVDAQTSIRLPDTVRAIMDRWT
LQMGFPVITVDTKTGNISQKHFLLDSESNVTRSSAFDYLWIVPISSIKNGVMQDHYWLRD
VSQAQNDLFKTASDDWVLLNVNVTGYFQVNYDEDNWRMIQHQLQTNLSVIPVINRAQVIY
DSFNLATAHMVPVTLALDNTLFLNGEKEYMPWQAALSSLSYFSLMFDRSEVYGPMKKYLR
KQVEPLFQHFETLTKNWTERPENLMDQYSEINAISTACSNGLPQCENLAKTLFDQWMSDP
ENNPIHPNLRSTIYCNAIAQGGQDQWDFAWGQLQQAQLVNEADKLRSALACSNEVWLLNR
YLGYTLNPDLIRKQDATSTINSIASNVIGQPLAWDFVQSNWKKLFQDYGGGSFSFSNLIQ
GVTRRFSSEFELQQLEQFKKNNMDVGFGSGTRALEQALEKTKANIKWVKENKEVVLNWFI
EHS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50105625
n/a
NameBDBM50105625
Synonyms:CHEMBL3597456
TypeSmall organic molecule
Emp. Form.C16H17ClN2O
Mol. Mass.288.772
SMILESCl.NC1CCc2cccc(-c3ccncc3)c2CC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: