Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase alpha-3
LigandBDBM50111390
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1509948
EC50 10400±n/a nM
Citation Jain, RMathur, MLan, JCostales, AAtallah, GRamurthy, SSubramanian, SSetti, LFeucht, PWarne, BDoyle, LBasham, SJefferson, ABLindvall, MAppleton, BAShafer, CM Discovery of Potent and Selective RSK Inhibitors as Biological Probes. J Med Chem58:6766-83 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Ribosomal protein S6 kinase alpha-3
Name:Ribosomal protein S6 kinase alpha-3
Synonyms:90 kDa ribosomal protein S6 kinase 3 | MAP kinase-activated protein kinase 1b | MAPK-activated protein kinase 1b | MAPKAP kinase 1b | MAPKAPK-1b | Mapkapk1b | RSK-2 | Ribosomal S6 kinase 2 | Ribosomal protein S6 kinase alpha-3 | Rps6ka-rs1 | Rps6ka3 | Rsk2 | S6K-alpha-3 | p90-RSK 3 | p90RSK3 | pp90RSK2
Type:PROTEIN
Mol. Mass.:83697.95
Organism:Mus musculus
Description:ChEMBL_108393
Residue:740
Sequence:
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEGSIKEIAITHHVKEGH
EKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERD
ILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALA
LDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVV
NRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLR
MLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDPE
FTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLK
DVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDL
KPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACD
IWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKML
HVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEP
VGRSTLAQRRGIKKITSTAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50111390
n/a
NameBDBM50111390
Synonyms:CHEMBL3604788
TypeSmall organic molecule
Emp. Form.C17H10F3NO
Mol. Mass.301.2626
SMILESOc1c(F)cc(cc1F)-c1cnccc1-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: