Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated potassium channel
LigandBDBM50115784
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1513935
IC50 123±n/a nM
Citation Murray, JKQian, YXLiu, BElliott, RAral, JPark, CZhang, XStenkilsson, MSalyers, KRose, MLi, HYu, SAndrews, KLColombero, AWerner, JGaida, KSickmier, EAMiu, PItano, AMcGivern, JGegg, CVSullivan, JKMiranda, LP Pharmaceutical Optimization of Peptide Toxins for Ion Channel Targets: Potent, Selective, and Long-Lived Antagonists of Kv1.3. J Med Chem58:6784-802 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated potassium channel
Name:Voltage-gated potassium channel
Synonyms:HGK5 | HLK3 | HPCN3 | HuKIII | Potassium voltage-gated channel subfamily A member 3 | Voltage-gated potassium channel subunit Kv1.3
Type:PROTEIN
Mol. Mass.:63835.47
Organism:Homo sapiens (Human)
Description:ChEMBL_1513935
Residue:575
Sequence:
MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDH
LLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLK
TLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIF
SEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVET
LCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSL
AILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE
ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIV
SNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHS
AFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50115784
NameBDBM50115784
Synonyms:CHEMBL3609038
TypeSmall organic molecule
Emp. Form.C169H275N57O48S7
Mol. Mass.4097.8
SMILES[H][C@@]12CCCN1C(=O)[C@@]([H])(NC(=O)[C@@]([H])(NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@]([H])(NC(=O)CNC(=O)[C@]1([H])CSSC[C@]3([H])NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc4ccccc4)NC(=O)[C@H](C)NC(=O)[C@@]([H])(NC(=O)[C@]([H])(CSSC[C@]([H])(NC(=O)[C@H](Cc4ccccc4)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc4ccc(O)cc4)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCSC)NC(=O)[C@H](CO)NC(=O)[C@H](Cc4cnc[nH]4)NC(=O)[C@H](CCCCN)NC3=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@]([H])([C@@H](C)O)C(=O)N1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC2=O)[C@@H](C)O)[C@@H](C)O)C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCCNC(N)=N)[C@@H](C)O)[C@@H](C)CC |r|
Structure
n/a