Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty acid desaturase 1
LigandBDBM50116781
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1513296
IC50 155±n/a nM
Citation Baugh, SDPabba, PKBarbosa, JCoulter, EDesai, UGay, JPGopinathan, SHan, QHari, RKimball, SDNguyen, HVNi, CYPowell, DRSmith, ATerranova, KMWilson, AYu, XCLombardo, VK Design, synthesis, and in vivo activity of novel inhibitors of delta-5 desaturase for the treatment of metabolic syndrome. Bioorg Med Chem Lett25:3836-9 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fatty acid desaturase 1
Name:Fatty acid desaturase 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:51985.80
Organism:Homo sapiens (Human)
Description:ChEMBL_1513296
Residue:444
Sequence:
MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVIS
HYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVE
RMGLMKANHVFFLLYLLHILLLDGAAWLTLWVFGTSFLPFLLCAVLLSAVQAQAGWLQHD
FGHLSVFSTSKWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNCFRKDPDINMHPFFFA
LGKILSVELGKQKKKYMPYNHQHKYFFLIGPPALLPLYFQWYIFYFVIQRKKWVDLAWMI
TFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQL
QATCNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
SAFADIIHSLKESGQLWLDAYLHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116781
NameBDBM50116781
Synonyms:CHEMBL2263369
TypeSmall organic molecule
Emp. Form.C13H10ClFN2O
Mol. Mass.264.683
SMILESNc1ccccc1C(=O)Nc1ccc(F)c(Cl)c1
Structure
n/a