Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-ketoglutarate-dependent dioxygenase FTO
LigandBDBM50117830
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1515853
IC50 4950±n/a nM
Citation He, WZhou, BLiu, WZhang, MShen, ZHan, ZJiang, QYang, QSong, CWang, RNiu, THan, SZhang, LWu, JGuo, FZhao, RYu, WChai, JChang, J Identification of A Novel Small-Molecule Binding Site of the Fat Mass and Obesity Associated Protein (FTO). J Med Chem58:7341-8 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-ketoglutarate-dependent dioxygenase FTO
Name:Alpha-ketoglutarate-dependent dioxygenase FTO
Synonyms:1.14.11.- | FTO | Fat mass and obesity-associated protein | KIAA1752
Type:PROTEIN
Mol. Mass.:58263.75
Organism:Homo sapiens
Description:ChEMBL_1515854
Residue:505
Sequence:
MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEE
LHKEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPV
KGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAAKEKANEDAVPLCMSADFPRVG
MGSSYNGQDEVDIKSRAAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRS
AVAVYSYSCEGPEEESEDDSHLEGRDPDIWHVGFKISWDIETPGLAIPLHQGDCYFMLDD
LNATHQHCVLAGSQPRFSSTHRVAECSTGTLDYILQRCQLALQNVCDDVDNDDVSLKSFE
PAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHE
VKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDD
ASMPLPFDLTDIVSELRGQLLEAKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50117830
n/a
NameBDBM50117830
Synonyms:CHEMBL3613953
TypeSmall organic molecule
Emp. Form.C17H16ClNO3
Mol. Mass.317.767
SMILESOc1cc(O)c(NC(=O)C2(CCC2)c2ccccc2)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: