Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XIII
LigandBDBM50131682
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1523559
Ki 900±n/a nM
Citation Maresca, AAkyuz, GOsman, SMAlOthman, ZSupuran, CT Inhibition of mammalian carbonic anhydrase isoforms I-XIV with a series of phenolic acid esters. Bioorg Med Chem23:7181-8 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase XIII
Name:Carbonic anhydrase XIII
Synonyms:CA-XIII | Carbonate dehydratase XIII | Carbonic anhydrase 13
Type:Enzyme
Mol. Mass.:29522.80
Organism:Mus musculus (mouse)
Description:Murine cloned isozyme
Residue:262
Sequence:
MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131682
NameBDBM50131682
Synonyms:CHEMBL3628132
TypeSmall organic molecule
Emp. Form.C25H24O6
Mol. Mass.420.4545
SMILESOc1cccc(CCOc2cccc(CCOC(=O)\C=C\c3ccc(O)c(O)c3)c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a