Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 4
LigandBDBM50131681
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1523552
Ki 24100±n/a nM
Citation Maresca, AAkyuz, GOsman, SMAlOthman, ZSupuran, CT Inhibition of mammalian carbonic anhydrase isoforms I-XIV with a series of phenolic acid esters. Bioorg Med Chem23:7181-8 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 4
Name:Carbonic anhydrase 4
Synonyms:CA-IV | Carbonate dehydratase IV | Carbonic anhydrase 4 (CA IV) | Carbonic anhydrase IV (CA IV)
Type:Enzyme
Mol. Mass.:35037.98
Organism:Homo sapiens (Human)
Description:P22748
Residue:312
Sequence:
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131681
NameBDBM50131681
Synonyms:CHEMBL3628131
TypeSmall organic molecule
Emp. Form.C25H24O6
Mol. Mass.420.4545
SMILESOc1ccc(CCOc2ccc(CCOC(=O)\C=C\c3ccc(O)c(O)c3)cc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a