Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosinase
LigandBDBM50132164
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1527144
IC50 90990±n/a nM
Citation Liu, JWu, FChen, C Design and synthesis of aloe-emodin derivatives as potent anti-tyrosinase, antibacterial and anti-inflammatory agents. Bioorg Med Chem Lett25:5142-6 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosinase
Name:Tyrosinase
Synonyms:Monophenol monooxygenase | Monophenol oxidase
Type:Protein
Mol. Mass.:63923.66
Organism:Agaricus bisporus (Common mushroom)
Description:O42713
Residue:556
Sequence:
MSLIATVGPTGGVKNRLNIVDFVKNEKFFTLYVRSLELLQAKEQHDYSSFFQLAGIHGLP
FTEWAKERPSMNLYKAGYCTHGQVLFPTWHRTYLSVLEQILQGAAIEVAKKFTSNQTDWV
QAAQDLRQPYWDWGFELMPPDEVIKNEEVNITNYDGKKISVKNPILRYHFHPIDPSFKPY
GDFATWRTTVRNPDRNRREDIPGLIKKMRLEEGQIREKTYNMLKFNDAWERFSNHGISDD
QHANSLESVHDDIHVMVGYGKIEGHMDHPFFAAFDPIFWLHHTNVDRLLSLWKAINPDVW
VTSGRNRDGTMGIAPNAQINSETPLEPFYQSGDKVWTSASLADTARLGYSYPDFDKLVGG
TKELIRDAIDDLIDERYGSKPSSGARNTAFDLLADFKGITKEHKEDLKMYDWTIHVAFKK
FELKESFSLLFYFASDGGDYDQENCFVGSINAFRGTAPETCANCQDNENLIQEGFIHLNH
YLARDLESFEPQDVHKFLKEKGLSYKLYSRGDKPLTSLSVKIEGRPLHLPPGEHRPKYDH
TQARVVFDDVAVHVIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132164
NameBDBM50132164
Synonyms:CHEMBL3633609
TypeSmall organic molecule
Emp. Form.C21H18O5
Mol. Mass.350.3646
SMILESOCc1cc(OCC=C)c2C(=O)c3c(OCC=C)cccc3C(=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a