Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMALT lymphoma-associated translocation (MALT1)
LigandBDBM50133349
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1525779
IC50 2500±n/a nM
Citation Lim, SMJeong, YLee, SIm, HTae, HSKim, BGPark, HDPark, JHong, S Identification of฿-Lapachone Analogs as Novel MALT1 Inhibitors To Treat an Aggressive Subtype of Diffuse Large B-Cell Lymphoma. J Med Chem58:8491-502 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MALT lymphoma-associated translocation (MALT1)
Name:MALT lymphoma-associated translocation (MALT1)
Synonyms:MALT lymphoma-associated translocation | MALT1 | MLT | Mucosa-associated lymphoid tissue lymphoma translocation protein 1 | Paracaspase
Type:Enzyme
Mol. Mass.:92257.81
Organism:Homo sapiens (Human)
Description:Q9UDY8
Residue:824
Sequence:
MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAEL
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQ
LLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAV
HVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMP
GSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD
SKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLK
APLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDAL
KVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCH
LTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQI
QLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVS
KDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRG
LGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCS
RTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50133349
NameBDBM50133349
Synonyms:CHEMBL3634993
TypeSmall organic molecule
Emp. Form.C12H11NO2
Mol. Mass.201.2212
SMILESCN(C)C1=CC(=O)C(=O)c2ccccc12 |t:3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a