Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosinase
LigandBDBM50134725
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1543862
IC50>200000±n/a nM
Citation Tan, XSong, YHPark, CLee, KWKim, JYKim, DWKim, KDLee, KWCurtis-Long, MJPark, KH Highly potent tyrosinase inhibitor, neorauflavane from Campylotropis hirtella and inhibitory mechanism with molecular docking. Bioorg Med Chem24:153-9 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosinase
Name:Tyrosinase
Synonyms:Monophenol monooxygenase | Monophenol oxidase
Type:Protein
Mol. Mass.:63923.66
Organism:Agaricus bisporus (Common mushroom)
Description:O42713
Residue:556
Sequence:
MSLIATVGPTGGVKNRLNIVDFVKNEKFFTLYVRSLELLQAKEQHDYSSFFQLAGIHGLP
FTEWAKERPSMNLYKAGYCTHGQVLFPTWHRTYLSVLEQILQGAAIEVAKKFTSNQTDWV
QAAQDLRQPYWDWGFELMPPDEVIKNEEVNITNYDGKKISVKNPILRYHFHPIDPSFKPY
GDFATWRTTVRNPDRNRREDIPGLIKKMRLEEGQIREKTYNMLKFNDAWERFSNHGISDD
QHANSLESVHDDIHVMVGYGKIEGHMDHPFFAAFDPIFWLHHTNVDRLLSLWKAINPDVW
VTSGRNRDGTMGIAPNAQINSETPLEPFYQSGDKVWTSASLADTARLGYSYPDFDKLVGG
TKELIRDAIDDLIDERYGSKPSSGARNTAFDLLADFKGITKEHKEDLKMYDWTIHVAFKK
FELKESFSLLFYFASDGGDYDQENCFVGSINAFRGTAPETCANCQDNENLIQEGFIHLNH
YLARDLESFEPQDVHKFLKEKGLSYKLYSRGDKPLTSLSVKIEGRPLHLPPGEHRPKYDH
TQARVVFDDVAVHVIN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50134725
NameBDBM50134725
Synonyms:CHEMBL3746877
TypeSmall organic molecule
Emp. Form.C26H28O6
Mol. Mass.436.4969
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-c1cc(ccc1-[#8])-[#6]-1-[#8]-c2cc(-[#8])c(-[#6])c(-[#8])c2-[#6](=O)-[#6]-1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a