Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasmepsin 2
LigandBDBM50145679
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1553805
IC50 24000±n/a nM
Citation Rasina, DOtikovs, MLeitans, JRecacha, RBorysov, OVKanepe-Lapsa, IDomraceva, IPantelejevs, TTars, KBlackman, MJJaudzems, KJirgensons, A Fragment-Based Discovery of 2-Aminoquinazolin-4(3H)-ones As Novel Class Nonpeptidomimetic Inhibitors of the Plasmepsins I, II, and IV. J Med Chem59:374-87 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Plasmepsin 2
Name:Plasmepsin 2
Synonyms:Aspartic hemoglobinase II | PFAPD | Plasmepsin 2 (PM-II) | Plasmepsin-II
Type:Enzyme
Mol. Mass.:51482.09
Organism:Plasmodium falciparum
Description:P46925
Residue:453
Sequence:
MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQKGFQILYVLLFCSVMCGLFYYVYE
NVWLQRDNEMNEILKNSEHLTIGFKVENAHDRILKTIKTHKLKNYIKESVNFLNSGLTKT
NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH
LYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPYKFIEVIDTNGFEPTYT
ASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIENALFTFYLPVHDKHTGFLTIGGIEER
FYEGPLTYEKLNHDLYWQITLDAHVGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDV
IKVPFLPFYVTLCNNSKLPTFEFTSENGKYTLEPEYYLQHIEDVGPGLCMLNIIGLDFPV
PTFILGDPFMRKYFTVFDYDNHSVGIALAKKNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50145679
NameBDBM50145679
Synonyms:CHEMBL3763552
TypeSmall organic molecule
Emp. Form.C16H17NO
Mol. Mass.239.3123
SMILESOC1CN(C1)C(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a