Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor
LigandBDBM50139847
Substrate/Competitorn/a
Meas. Tech.ChEBML_1553993
Ki 0.090000±n/a nM
Citation Couhert, ADelagrange, PCaignard, DHChartier, ASuzenet, FGuillaumet, G Synthesis of 2-arylfuro[3,2-b]pyridines: Effect of the C2-aryl group on melatoninergic activity. Eur J Med Chem109:268-75 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melatonin receptor
Name:Melatonin receptor
Synonyms:MTNR1B | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2)
Type:Enzyme
Mol. Mass.:40203.54
Organism:Homo sapiens (Human)
Description:P49286
Residue:362
Sequence:
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50139847
NameBDBM50139847
Synonyms:CHEMBL3764765
TypeSmall organic molecule
Emp. Form.C22H20N2O3
Mol. Mass.360.4058
SMILESCOc1ccc2oc(c(CCNC(C)=O)c2n1)-c1ccc2ccccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a