Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor
LigandBDBM50144221
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1551498
Ki 0.090000±n/a nM
Citation Landagaray, EEttaoussi, MDuroux, RBoutin, JACaignard, DHDelagrange, PMelnyk, PBerthelot, PYous, S Melatonergic ligands: Design, synthesis and pharmacological evaluation of novel series of naphthofuranic derivatives. Eur J Med Chem109:360-70 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melatonin receptor
Name:Melatonin receptor
Synonyms:MTNR1B | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2)
Type:Enzyme
Mol. Mass.:40203.54
Organism:Homo sapiens (Human)
Description:P49286
Residue:362
Sequence:
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50144221
NameBDBM50144221
Synonyms:CHEMBL3759802
TypeSmall organic molecule
Emp. Form.C17H17NO3
Mol. Mass.283.3218
SMILESCOc1ccc2ccc3occ(CCNC(C)=O)c3c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a