Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase II
LigandBDBM50335638
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1552124
IC50 11±n/a nM
Citation Ohno, HMinamiguchi, DNakamura, SShu, KOkazaki, SHonda, MMisu, RMoriwaki, HNakanishi, SOishi, SKinoshita, TNakanishi, IFujii, N Structure-activity relationship study of 4-(thiazol-5-yl)benzoic acid derivatives as potent protein kinase CK2 inhibitors. Bioorg Med Chem24:1136-41 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Casein kinase II
Name:Casein kinase II
Synonyms:CSNK2A2 | Casein kinase II alpha (prime) | Casein kinase II subunit alpha (CK2A2) | Casein kinase II subunit alpha (CSNK2A2) | Casein kinase II subunit alpha' (CK2A2)
Type:Protein
Mol. Mass.:41223.82
Organism:Homo sapiens (Human)
Description:n/a
Residue:350
Sequence:
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI
TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT
DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA
EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNY
DQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50335638
NameBDBM50335638
Synonyms:5-(3-Chlorophenylamino)benzo[c][2,6]naphthyridine-8-carboxylic acid | 5-[(3-chlorophenyl)amino]benzo[c][2,6]naphthyridine-8-carboxylic acid | CHEMBL1230165 | US9062043, Table 13, Compound 17 | US9062043, Table 20b, Compound 12
TypeSmall organic molecule
Emp. Form.C19H12ClN3O2
Mol. Mass.349.77
SMILESOC(=O)c1ccc2c(c1)nc(Nc1cccc(Cl)c1)c1ccncc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a