Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II receptor
LigandBDBM50156173
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1555129
Ki 0.400000±n/a nM
Citation Sallander, JWallinder, CHallberg, AÅqvist, JGutiérrez-de-Terán, H Structural determinants of subtype selectivity and functional activity of angiotensin II receptors. Bioorg Med Chem Lett26:1355-9 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II receptor
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Angiotensin II, central | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41201.61
Organism:Homo sapiens (Human)
Description:Angiotensin II, central 0 0::P50052
Residue:363
Sequence:
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156173
NameBDBM50156173
Synonyms:(1-((2'-(1H-tetrazol-5-yl)biphenyl-4-yl)methyl)-2-butyl-4-chloro-1H-imidazol-5-yl)methanol | CHEMBL189568 | butyl (5-isobutylthien-2-yl)sulfonylcarbamate derivative | butyl 3-(4-((1H-imidazol-1-yl)methyl)phenyl)-5-isobutylthiophen-2-ylsulfonylcarbamate
TypeSmall organic molecule
Emp. Form.C23H29N3O4S2
Mol. Mass.475.624
SMILESCCCCOC(=O)NS(=O)(=O)c1sc(CC(C)C)cc1-c1ccc(Cn2ccnc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a