Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDOPAMINE
LigandBDBM50145616
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1556020
Ki 0.098300±n/a nM
Citation Fiorino, FCiano, AMagli, ESeverino, BCorvino, APerissutti, EFrecentese, FDi Vaio, PIzzo, AACapasso, RMassarelli, PNencini, CRossi, IKedzierska, EOrzelska-G˛rka, JBielenica, ASantagada, VCaliendo, G Synthesis, in vitro and in vivo pharmacological evaluation of serotoninergic ligands containing an isonicotinic nucleus. Eur J Med Chem110:133-50 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DOPAMINE
Name:Dopamine receptors; D1 & D2
Synonyms:D(1A) dopamine receptor | DOPAMINE D1 | Dopamine D1 high | Dopamine D1 low | Dopamine receptor | Dopamine receptor D1 | Dopamine1-like
Type:Enzyme Catalytic Domain
Mol. Mass.:49429.75
Organism:RAT
Description:DOPAMINE 0 RAT::P18901
Residue:446
Sequence:
MAPNTSTMDEAGLPAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNF
FVISLAVSDLLVAVLVMPWKAVAEIAGFWPLGPFCNIWVAFDIMCSTASILNLCVISVDR
YWAISSPFQYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTWPLDGNFTSLED
TEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYTSIYRIAQKQIRRISALERAAVHAKN
CQTTAGNGNPVECAQSESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFISNCMVPFCGS
EETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFQKAFSTLLGCYRLCPTTNNAIET
VSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGIAKPLEKLSPAL
SVILDYDTDVSLEKIQPVTHSGQHST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50145616
NameBDBM50145616
Synonyms:CHEMBL3763331
TypeSmall organic molecule
Emp. Form.C26H29ClF2N4O
Mol. Mass.486.984
SMILESCl.Fc1ccc(cc1)C(N1CCN(CCCNC(=O)c2ccncc2)CC1)c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a