Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInhibitor of nuclear factor kappa-B kinase subunit beta
LigandBDBM50146936
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1553193
IC50 500±n/a nM
Citation Kim, DKim, YGSeo, JHShin, KJ Identification and characterization of potent, selective and metabolically stable IKK▀ inhibitor. Bioorg Med Chem Lett26:1120-3 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inhibitor of nuclear factor kappa-B kinase subunit beta
Name:Inhibitor of nuclear factor kappa-B kinase subunit beta
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:86687.79
Organism:Mus musculus
Description:ChEMBL_835035
Residue:757
Sequence:
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQATGEQIAIKQCRQELSPKNRNRWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRRYLNQFENCCGLREG
AVLTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEKRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
VDIVVSEDLNGAVKFSSSLPFPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPQYGPNGCF
RALDDILNLKLVHVLNMVTGTVHTYPVTEDESLQSLKTRIQENTGILETDQELLQKAGLV
LLPDKPATQCISDSKTNEGLTLDMDLVFLLDNSKINYETQITPRPPPESVSCILQEPKRN
LSFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMSLLRNNSCLSKMKNAMASTAQQLK
AKLDFFKTSIQIDLEKYKEQTEFGITSDKLLLAWREMEQAVEQCGRENDVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRKLREKPRDQRTEGDSQEMVRLLLQAIQS
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDERTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNVSRLSHPGQLMSQPSSACDSLPESDKKSEELVAEAHALCSRLE
SALQDTVKEQDRSFTTLDWSWLQMEDEERCSLEQACD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50146936
NameBDBM50146936
Synonyms:CHEMBL3765499
TypeSmall organic molecule
Emp. Form.C30H30FN3O3S2
Mol. Mass.563.706
SMILESCN1CCN(CCCOc2ccc(cc2)N2C(=S)S\C(=C/c3ccc(Oc4ccc(F)cc4)cc3)C2=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a