Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 2
LigandBDBM50148605
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1556385
Kd 1470±n/a nM
Citation Baud, MGLin-Shiao, EZengerle, MTallant, CCiulli, A New Synthetic Routes to Triazolo-benzodiazepine Analogues: Expanding the Scope of the Bump-and-Hole Approach for Selective Bromo and Extra-Terminal (BET) Bromodomain Inhibition. J Med Chem59:1492-500 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 2
Name:Bromodomain-containing protein 2
Synonyms:Bromodomain-containing protein 2 | Bromodomain-containing protein 2 (BRD2)
Type:Protein
Mol. Mass.:88085.95
Organism:Homo sapiens (Human)
Description:P25440
Residue:801
Sequence:
MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPAN
PPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQP
MDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASM
PQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNI
PHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPA
SPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKEL
LSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL
MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSES
SSEESSSESSSEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQG
PISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAAL
GPSGFGPSGGSGTKLPKKATKTAPPALPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGE
KLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELERYVLSCLRKKPRKPYTIKKP
VGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKANEKTESSSAQQVAVSRLSASSSS
SDSSSSSSSSSSSDTSDSDSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148605
NameBDBM50148605
Synonyms:CHEMBL3769729
TypeSmall organic molecule
Emp. Form.C22H21ClN4O3
Mol. Mass.424.88
SMILES[H][C@]1(N=C(c2ccc(Cl)cc2)c2cc(OC)ccc2-n2c(C)nnc12)[C@@H](C)C(=O)OC |r,t:2|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a