Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled bile acid receptor 1
LigandBDBM50160886
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1572016
EC50 1.5±n/a nM
Citation Agarwal, SPatil, AAware, UDeshmukh, PDarji, BSasane, SSairam, KVPriyadarsiny, PGiri, PPatel, HGiri, SJain, MDesai, RC Discovery of a Potent and Orally Efficacious TGR5 Receptor Agonist. ACS Med Chem Lett7:51-5 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
G-protein coupled bile acid receptor 1
Name:G-protein coupled bile acid receptor 1
Synonyms:BG37 | M-BAR | TGR5 | hBG37 | hGPCR19
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:35260.02
Organism:Homo sapiens (human)
Description:CHO cells transiently transfected with hTGR5.
Residue:330
Sequence:
MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50160886
NameBDBM50160886
Synonyms:CHEMBL3794442
TypeSmall organic molecule
Emp. Form.C32H33FN4O3S
Mol. Mass.572.693
SMILESCOc1ccc(cc1OC)C(C)(C)c1cnc(SCCOc2ccc(cc2)-n2ccnc2C)n1-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a