Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase pim-1
LigandBDBM50445152
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1570460
Ki 90±n/a nM
Citation Nishiguchi, GABurger, MTHan, WLan, JAtallah, GTamez, VLindvall, MBellamacina, CGarcia, PFeucht, PZavorotinskaya, TDai, YWong, K Design, synthesis and structure activity relationship of potent pan-PIM kinase inhibitors derived from the pyridyl carboxamide scaffold. Bioorg Med Chem Lett26:2328-32 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase pim-1
Name:Serine/threonine-protein kinase PIM
Synonyms:PIM-1 Kinase | PIM1 | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1)
Type:Protein
Mol. Mass.:35681.82
Organism:Homo sapiens (Human)
Description:P11309
Residue:313
Sequence:
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50445152
NameBDBM50445152
Synonyms:CHEMBL3103881
TypeSmall organic molecule
Emp. Form.C17H20N4O2S
Mol. Mass.344.431
SMILESCC(=O)Nc1nc(cs1)C(=O)Nc1ccccc1N1CCCCC1
Structure
n/a