Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurotensin receptor
LigandBDBM50159155
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1569166
Ki 0.740000±n/a nM
Citation Keller, MKuhn, KKEinsiedel, JHübner, HBiselli, SMollereau, CWifling, DSvobodová, JBernhardt, GCabrele, CVanderheyden, PMGmeiner, PBuschauer, A Mimicking of Arginine by Functionalized N(¿)-Carbamoylated Arginine As a New Broadly Applicable Approach to Labeled Bioactive Peptides: High Affinity Angiotensin, Neuropeptide Y, Neuropeptide FF, and Neurotensin Receptor Ligands As Examples. J Med Chem59:1925-45 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neurotensin receptor
Name:Neurotensin receptor
Synonyms:Levocabastine-sensitive neurotensin receptor | NT-R-2 | NTR2 | NTR2 receptor | Neurotensin receptor 2 | Neurotensin receptor type 2
Type:PROTEIN
Mol. Mass.:45404.76
Organism:Homo sapiens (Human)
Description:ChEMBL_1281495
Residue:410
Sequence:
METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKA
RAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAY
ATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHEL
ETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQV
PSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLR
AIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNA
VSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50159155
NameBDBM50159155
Synonyms:CHEMBL3786852
TypeSmall organic molecule
Emp. Form.C51H78F12N14O17
Mol. Mass.1387.2295
SMILESOC(=O)C(F)(F)F.OC(=O)C(F)(F)F.OC(=O)C(F)(F)F.OC(=O)C(F)(F)F.CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CCCN\C(N)=N\C(=O)NCCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a