Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2b
LigandBDBM50159502
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1569180
Ki 0.500000±n/a nM
Citation El Maatougui, AAzuaje, JGonzález-Gómez, MMiguez, GCrespo, ACarbajales, CEscalante, LGarcía-Mera, XGutiérrez-de-Terán, HSotelo, E Discovery of Potent and Highly Selective A2B Adenosine Receptor Antagonist Chemotypes. J Med Chem59:1967-83 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2b
Name:Adenosine receptor A2b
Synonyms:ADENOSINE A2B | ADORA2B | Adenosine receptor A2B (A2B)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36341.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:332
Sequence:
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50159502
n/a
NameBDBM50159502
Synonyms:CHEMBL3786849
TypeSmall organic molecule
Emp. Form.C29H34N8O2
Mol. Mass.526.6327
SMILESCC(=O)NCCNc1nc(nc2nc([nH]c12)C(=O)N1CCN(CCCc2ccccc2)CC1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: