Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 4
LigandBDBM50166960
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1573310
EC50 1.6±n/a nM
Citation Gogliotti, RDEngers, DWGarcia-Barrantes, PMPanarese, JDGentry, PRBlobaum, ALMorrison, RDDaniels, JSThompson, ADJones, CKConn, PJNiswender, CMLindsley, CWHopkins, CR Discovery of 3-aminopicolinamides as metabotropic glutamate receptor subtype 4 (mGlu4) positive allosteric modulator warheads engendering CNS exposure and in vivo efficacy. Bioorg Med Chem Lett26:2915-2919 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 4
Name:Metabotropic glutamate receptor 4
Synonyms:GRM4 | Glutamate receptor, metabotropic 4 | Metabotropic glutamate receptor 4 | mGluR4 | metabotropic glutamate 4
Type:Protein
Mol. Mass.:101899.95
Organism:Homo sapiens (Human)
Description:Q14833
Residue:912
Sequence:
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIA
ATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALAT
KQTYVTYTNHAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50166960
n/a
NameBDBM50166960
Synonyms:CHEMBL3799708
TypeSmall organic molecule
Emp. Form.C20H23ClN4O2
Mol. Mass.386.875
SMILESCC(C)CC1CN(C(=O)C1)c1ccc(NC(=O)c2ncccc2N)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: