Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase Kit (Kit)
LigandBDBM158154
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1577164
IC50>1000±n/a nM
Citation Menichincheri, MArdini, EMagnaghi, PAvanzi, NBanfi, PBossi, RBuffa, LCanevari, GCeriani, LColombo, MCorti, LDonati, DFasolini, MFelder, EFiorelli, CFiorentini, FGalvani, AIsacchi, ABorgia, ALMarchionni, CNesi, MOrrenius, CPanzeri, APesenti, ERusconi, LSaccardo, MBVanotti, EPerrone, EOrsini, P Discovery of Entrectinib: A New 3-Aminoindazole As a Potent Anaplastic Lymphoma Kinase (ALK), c-ros Oncogene 1 Kinase (ROS1), and Pan-Tropomyosin Receptor Kinases (Pan-TRKs) inhibitor. J Med Chem59:3392-408 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase Kit (Kit)
Name:Tyrosine-protein kinase Kit (Kit)
Synonyms:CD117 antigen | CD_antigen=CD117 | KIT | Mast/stem cell growth factor receptor | Mast/stem cell growth factor receptor Kit (cKIT) | Proto-oncogene c-Kit | Proto-oncogene tyrosine-protein kinase Kit | SCFR | Stem cell growth factor receptor | Tyrosine Kinase c-Kit | Tyrosine-protein kinase Kit | Tyrosine-protein kinase Kit (c-Kit) | V-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (avian) | VEGF-receptor 2 and stem cell growth factor receptor (KDR and KIT)
Type:Protein
Mol. Mass.:109869.37
Organism:Homo sapiens (Human)
Description:P10721
Residue:976
Sequence:
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM158154
n/a
NameBDBM158154
Synonyms:US9029356, 11 | US9255087, 11
TypeSmall organic molecule
Emp. Form.C31H34F2N6O2
Mol. Mass.560.6375
SMILESCN1CCN(CC1)c1ccc(C(=O)Nc2n[nH]c3ccc(Cc4cc(F)cc(F)c4)cc23)c(NC2CCOCC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: