Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetActivator of S phase kinase DBF4/Cell division cycle 7-related protein kinase
LigandBDBM158154
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1577171
IC50>10000±n/a nM
Citation Menichincheri, MArdini, EMagnaghi, PAvanzi, NBanfi, PBossi, RBuffa, LCanevari, GCeriani, LColombo, MCorti, LDonati, DFasolini, MFelder, EFiorelli, CFiorentini, FGalvani, AIsacchi, ABorgia, ALMarchionni, CNesi, MOrrenius, CPanzeri, APesenti, ERusconi, LSaccardo, MBVanotti, EPerrone, EOrsini, P Discovery of Entrectinib: A New 3-Aminoindazole As a Potent Anaplastic Lymphoma Kinase (ALK), c-ros Oncogene 1 Kinase (ROS1), and Pan-Tropomyosin Receptor Kinases (Pan-TRKs) inhibitor. J Med Chem59:3392-408 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Activator of S phase kinase DBF4/Cell division cycle 7-related protein kinase
Name:Activator of S phase kinase DBF4/Cell division cycle 7-related protein kinase
Synonyms:CDC7/DBF4 (Cell division cycle 7-related protein kinase/Activator of S phase kinase)
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 747259
Components:This complex has 2 components.
Component 1
Name:Cell division cycle 7-related protein kinase
Synonyms:Cell division cycle 7-related protein kinase | Cell division cycle 7-related protein kinase (CDC7)
Type:Protein
Mol. Mass.:63908.16
Organism:Homo sapiens (Human)
Description:O00311
Residue:574
Sequence:
MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKI
EDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGV
KYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKP
SNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSG
PVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
ESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVC
SICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQ
GHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPD
EAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:DBF4
Synonyms:Activator of S phase kinase | Chiffon homolog A | DBF4-type zinc finger-containing protein 1 | DBF4A | Protein DBF4 homolog A
Type:Regulatory subunit
Mol. Mass.:76869.65
Organism:Homo sapiens (human)
Description:n/a
Residue:674
Sequence:
MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTI
SEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAYTAETTSPH
PSHDGSSFKSPDTVCLSRGKLLVEKAIKDHDFIPSNSILSNALSWGVKILHIDDIRYYIE
QKKKELYLLKKSSTSVRDGGKRVGSGAQKTRTGRLKKPFVKVEDMSQLYRPFYLQLTNMP
FINYSIQKPCSPFDVDKPSSMQKQTQVKLRIQTDGDKYGGTSIQLQLKEKKKKGYCECCL
QKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKRIKYSVGSLSP
VSASVLKKTEQKEKVELQHISQKDCQEDDTTVKEQNFLYKETQETEKKLLFISEPIPHPS
NELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVD
HYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ
EHLTVQAKAPFHTPPEEPNECDFKNMDSLPSGKIHRKVKIILGRNRKENLEPNAEFDKRT
EFITQEENRICSSPVQSLLDLFQTSEEKSEFLGFTSYTEKSGICNVLDIWEEENSDNLLT
AFFSSPSTSTFTGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM158154
n/a
NameBDBM158154
Synonyms:US9029356, 11 | US9255087, 11
TypeSmall organic molecule
Emp. Form.C31H34F2N6O2
Mol. Mass.560.6375
SMILESCN1CCN(CC1)c1ccc(C(=O)Nc2n[nH]c3ccc(Cc4cc(F)cc(F)c4)cc23)c(NC2CCOCC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: