Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty acid-binding protein 4 (FABP4)
LigandBDBM50212873
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1583389
Ki 160±n/a nM
Citation Tagami, UTakahashi, KIgarashi, SEjima, CYoshida, TTakeshita, SMiyanaga, WSugiki, MTokumasu, MHatanaka, TKashiwagi, TIshikawa, KMiyano, HMizukoshi, T Interaction Analysis of FABP4 Inhibitors by X-ray Crystallography and Fragment Molecular Orbital Analysis. ACS Med Chem Lett7:435-9 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fatty acid-binding protein 4 (FABP4)
Name:Fatty acid-binding protein 4 (FABP4)
Synonyms:A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | Fatty acid binding protein adipocyte | Fatty acid-binding protein 4
Type:Enzyme
Mol. Mass.:14719.23
Organism:Homo sapiens (Human)
Description:P15090
Residue:132
Sequence:
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50212873
NameBDBM50212873
Synonyms:((2'-(5-ETHYL-3,4-DIPHENYL-1H-PYRAZOL-1-YL)-3-BIPHENYLYL)OXY)ACETIC ACID | BMS309403 | CHEMBL247920 | [2'-(5-Ethyl-3,4-diphenyl-pyrazol-1-yl)-biphenyl-3-yloxy]-acetic acid
TypeSmall organic molecule
Emp. Form.C31H26N2O3
Mol. Mass.474.5497
SMILESCCc1c(c(nn1-c1ccccc1-c1cccc(OCC(O)=O)c1)-c1ccccc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a