Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 9
LigandBDBM50398334
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1583874
IC50 5.0±n/a nM
Citation Pandya, BABaber, CChan, AChamberlain, BChandonnet, HGoss, JHopper, TLippa, BPoutsiaka, KRomero, JStucka, SVaroglu, MZhang, JZhang, X Discovery of indole inhibitors of chemokine receptor 9 (CCR9). Bioorg Med Chem Lett26:3322-3325 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 9
Name:C-C chemokine receptor type 9
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42023.90
Organism:Homo sapiens (Human)
Description:ChEMBL_1510356
Residue:369
Sequence:
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFI
VGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCK
VVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALC
IPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHT
LIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQ
VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL
ETTSGALSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50398334
NameBDBM50398334
Synonyms:CHEMBL2178578
TypeSmall organic molecule
Emp. Form.C22H21ClN2O4S
Mol. Mass.444.931
SMILESCC(C)(C)c1ccc(cc1)S(=O)(=O)Nc1ccc(Cl)cc1C(=O)c1cc[n+]([O-])cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a