Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2A adrenergic receptor
LigandBDBM50070328
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1583767
EC50 178±n/a nM
Citation Vucicevic, JSrdic-Rajic, TPieroni, MLaurila, JMPerovic, VTassini, SAzzali, ECostantino, GGlisic, SAgbaba, DScheinin, MNikolic, KRadi, MVeljkovic, N A combined ligand- and structure-based approach for the identification of rilmenidine-derived compounds which synergize the antitumor effects of doxorubicin. Bioorg Med Chem24:3174-83 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-2A adrenergic receptor
Name:Alpha-2A adrenergic receptor
Synonyms:Adrenergic alpha2A | Adrenergic receptor alpha | Alpha-2 adrenergic receptor subtype C10 | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | alpha-2A adrenergic receptor [Homo sapiens]
Type:Enzyme
Mol. Mass.:48979.91
Organism:Homo sapiens (Human)
Description:P08913
Residue:450
Sequence:
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGG
PQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA
APPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD
HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50070328
n/a
NameBDBM50070328
Synonyms:CHEBI:8862 | RILMENIDINE | Rilmenidine
TypeSmall organic molecule
Emp. Form.C10H16N2O
Mol. Mass.180.2468
SMILESC1CC1C(NC1=NCCO1)C1CC1 |t:6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: