Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target2-amino-4-hydroxy-6-hydroxymethyldihydropteridin e pyrophosphokinase
LigandBDBM50181536
Substrate/Competitorn/a
Meas. Tech.ChEBML_1585631
Kd 2100±n/a nM
Citation Dennis, MLPitcher, NPLee, MDDeBono, AJWang, ZCHarjani, JRRahmani, RCleary, BPeat, TSBaell, JBSwarbrick, JD Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli. J Med Chem59:5248-63 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
2-amino-4-hydroxy-6-hydroxymethyldihydropteridin e pyrophosphokinase
Name:2-amino-4-hydroxy-6-hydroxymethyldihydropteridin e pyrophosphokinase
Synonyms:2-amino-4-hydroxy-6-hydroxymethyldihydropteridin e pyrophosphokinase | 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase | ABW28_08200 | ABW29_07060 | ABW30_08355 | ABW31_07355 | ABW32_09260 | ABW33_07270 | CH51_02625 | EP20_13750 | EP54_02575 | EQ90_02390 | ERS157365_02703 | ERS157366_02614 | ERS157367_02647 | ERS157368_02595 | ERS157369_02716 | ERS157370_02666 | ERS157371_02678 | ERS157372_02305 | ERS157373_02672 | ERS157374_02574 | ERS157376_02631 | ERS157379_02647 | ERS157380_02607 | ERS157381_02694 | ERS157382_02566 | ERS157383_02110 | ERS157384_02627 | ERS157385_02636 | ERS157386_02628 | ERS157387_02431 | ERS157388_02574 | ERS157389_02365 | ERS157390_02577 | ERS157391_02701 | ERS157393_01767 | ERS157394_02317 | ERS157395_02575 | ERS157409_02670 | ERS195389_02625 | ERS195391_02693 | ERS234133_02777 | ERS365739_02469 | ERS365740_02669 | ERS365745_02644 | ERS365747_02604 | ERS365748_02619 | ERS365749_02735 | ERS365754_02697 | ERS365755_02434 | ERS365758_02687 | ERS365763_02601 | ERS365766_02612 | ERS365767_02653 | ERS365772_02765 | ERS365775_02734 | ERS365779_02402 | ERS365784_02589 | ERS365787_02733 | ERS365790_02581 | ERS365791_02749 | ERS365794_02498 | ERS365795_02604 | ERS365796_02534 | ERS365797_02514 | ERS365805_02596 | ERS365808_02517 | ERS365809_02622 | ERS365811_02615 | ERS365815_02596 | ERS365816_02517 | ERS365820_02706 | ERS365821_02633 | ERS365822_02635 | ERS365824_02579 | ERS365826_02612 | ERS365827_02672 | ERS365828_02722 | ERS365829_02674 | ERS365831_02708 | ERS409790_02492 | ERS409806_02728 | ERS409812_02685 | ERS410207_02669 | ERS410215_02553 | ERS410239_02551 | ERS410276_02721 | ERS410284_02638 | ERS410292_02708 | ERS410300_02722 | ERS410308_02730 | ERS410318_02753 | ERS410326_02569 | ERS410334_02577 | ERS410342_02382 | ERS410365_02721 | ERS410377_02748 | ERS410378_02510 | ERS410379_02661 | ERS410380_02657 | ERS410386_02420 | ERS410387_02709 | ERS410393_02761 | ERS410395_02618 | ERS410401_02764 | ERS410402_02654 | ERS410409_02646 | ERS410412_02583 | ERS410417_02612 | ERS410418_02700 | ERS410419_02717 | ERS410427_02722 | ERS410441_02766 | ERS410449_02701 | ERS410450_02588 | ERS410451_02621 | ERS410558_01856 | ERS410566_02502 | ERS410574_02446 | ERS410589_02516 | ERS410605_02664 | ERS410613_02617 | ERS410621_02576 | ERS410629_02511 | ERS410645_02678 | ERS410677_02575 | ERS410692_02648 | ERS410708_02707 | ERS410716_02594 | ERS410740_02709 | ERS410747_02659 | ERS410748_02665 | ERS410755_02690 | ERS410756_02718 | ERS410765_02659 | ERS410771_02672 | ERS410779_02600 | ERS410787_02651 | ERS410789_02690 | ERS410796_02576 | ERS410797_00883 | ERS410811_02699 | ERS410819_02661 | ERS410840_02680 | ERS410848_02714 | ERS410863_02689 | ERS410867_02682 | ERS410868_02674 | ERS410872_02635 | ERS410876_02690 | ERS410888_02755 | ERS410890_02761 | ERS410896_02554 | ERS410898_02677 | ERS410899_02649 | ERS410903_02744 | ERS410906_02552 | ERS410907_02605 | ERS410911_02636 | ERS410915_02761 | ERS410923_02655 | ERS410929_02635 | ERS410933_02752 | ERS410938_02439 | ERS410939_02663 | ERS410946_02654 | ERS410947_02673 | ERS410949_02663 | ERS410954_02680 | ERS410955_02671 | ERS410961_02634 | ERS410962_02660 | ERS410963_02688 | ERS410970_02653 | ERS410977_02643 | ERS410985_02645 | ERS410986_02592 | ERS410994_02631 | ERS410996_02594 | ERS411001_02682 | ERS411002_02760 | ERS411009_02715 | ERS411010_02700 | ERS411017_02652 | ERS411018_02636 | ERS411020_02662 | ERS411049_02708 | ERS411112_02700 | ERS411120_02681 | ERS411126_02634 | ERS411131_02649 | ERS411132_02630 | ERS411133_02681 | ERS411140_02449 | ERS411141_02724 | ERS411142_02472 | ERS411147_02706 | ERS411149_02786 | ERS411150_02674 | ERS411157_02682 | ERS411163_02721 | ERS411165_02457 | ERS411167_02654 | ERS411168_02695 | ERS411171_02664 | ERS411172_02631 | ERS411173_02675 | ERS411176_02653 | ERS411179_02707 | ERS411184_02575 | ERS411187_02618 | ERS411189_02635 | ERS411192_02777 | ERS411199_02671 | ERS411200_02690 | ERS411204_02646 | ERS411205_02684 | ERS411207_02697 | ERS411208_02692 | ERS411213_02650 | ERS432053_02652 | ERS432061_02723 | ERS432065_02730 | ERS432077_02651 | ERS432085_02697 | ERS432093_02732 | ERS432122_02514 | ERS432139_02644 | ERS432172_02597 | ERS432195_02663 | ERS432202_02610 | ERS432204_02526 | ERS445051_00480 | ERS445052_00036 | RK61_01190 | RK62_03755 | RK63_07290 | RK64_03025 | RK65_06210 | RK66_15440 | RK68_07210 | RK69_06320 | RK70_07685 | RK71_07250 | RK73_13780 | RK76_09445 | RK81_08765 | RK82_13545 | RK85_02765 | RK86_04470 | RK89_09250 | RK91_06295 | RK92_00205 | RK93_05480 | RK94_00215 | RL00_08220 | RL01_08280 | RL02_06325 | RL04_00815 | RL07_15690 | SAFDA_0458 | TM61_02105 | folK
Type:PROTEIN
Mol. Mass.:18024.64
Organism:Staphylococcus aureus
Description:ChEMBL_109736
Residue:158
Sequence:
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGINVSNISPIYETAPVGYTEQPNFLNLCVE
IQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNE
RAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50181536
n/a
NameBDBM50181536
Synonyms:CHEMBL3818636
TypeSmall organic molecule
Emp. Form.C13H10F3N5O2S
Mol. Mass.357.311
SMILESNc1nc2[nH]c(SCc3ccc(OC(F)(F)F)cc3)nc2c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: