Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-secretase 1 (BACE1)
LigandBDBM50280646
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1586622
IC50<1000±n/a nM
Citation Costanzo, PCariati, LDesiderio, DSgammato, RLamberti, AArcone, RSalerno, RNardi, MMasullo, MOliverio, M Design, Synthesis, and Evaluation of Donepezil-Like Compounds as AChE and BACE-1 Inhibitors. ACS Med Chem Lett7:470-5 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-secretase 1 (BACE1)
Name:Beta-secretase 1 (BACE1)
Synonyms:Beta-secretase 1
Type:Enzyme
Mol. Mass.:55739.56
Organism:Mus musculus (Mouse)
Description:P56818
Residue:501
Sequence:
MAPALHWLLLWVGSGMLPAQGTHLGIRLPLRSGLAGPPLGLRLPRETDEESEEPGRRGSF
VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSST
YRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGIL
GLAYAEIARPDDSLEPFFDSLVKQTHIPNIFSLQLCGAGFPLNQTEALASVGGSMIIGGI
DHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
VFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRIT
ILPQQYLRPVEDVATSQDDCYKFAVSQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC
HVHDEFRTAAVEGPFVTADMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQW
RCLRCLRHQHDDFADDISLLK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50280646
NameBDBM50280646
Synonyms:2-[1-(1-Benzyl-piperidin-4-yl)-meth-(E)-ylidene]-5,6-dimethoxy-indan-1-one | CHEMBL168938
TypeSmall organic molecule
Emp. Form.C24H27NO3
Mol. Mass.377.4761
SMILESCOc1cc2C\C(=C/C3CCN(Cc4ccccc4)CC3)C(=O)c2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a