Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptor
LigandBDBM50182744
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1586515
Ki 1361±n/a nM
Citation Ofori, EZhu, XYEtukala, JRPeprah, KJordan, KRAdkins, AABricker, BAKang, HJHuang, XPRoth, BLAblordeppey, SY Design and synthesis of dual 5-HT1A and 5-HT7 receptor ligands. Bioorg Med Chem24:3464-71 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine receptor
Name:Dopamine receptor
Synonyms:D(4) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.4
Type:Enzyme Catalytic Domain
Mol. Mass.:41307.65
Organism:RAT
Description:DOPAMINE D4.4 0 RAT::P30729
Residue:387
Sequence:
MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAAALVGGVLLIGMVLAGNSLVCVSVASER
ILQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI
FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVAAPVVCGLNDVPGRDPTVC
CLEDRDYVVYSSICSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV
SDPTQGPLFSDCPPPSPSLRTSPTVSSRPESDLSQSPCSPGCLLPDAALAQPPAPSSRRK
RGAKITGRERKAMRVLPVVVGAFLMCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN
SALNPIIYTIFNAEFRSVFRKTLRLRC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50182744
NameBDBM50182744
Synonyms:CHEMBL3818669
TypeSmall organic molecule
Emp. Form.C20H20N2O2
Mol. Mass.320.385
SMILESO=C1N(CCCCN2Cc3ccccc3C2)C(=O)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a