Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMaternal embryonic leucine zipper kinase
LigandBDBM50185436
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1588028
IC50 4.0±n/a nM
Citation Touré, BBGiraldes, JSmith, TSprague, ERWang, YMathieu, SChen, ZMishina, YFeng, YYan-Neale, YShakya, SChen, DMeyer, MPuleo, DBrazell, JTStraub, CSage, DWright, KYuan, YChen, XDuca, JKim, STian, LMartin, EHurov, KShao, W Toward the Validation of Maternal Embryonic Leucine Zipper Kinase: Discovery, Optimization of Highly Potent and Selective Inhibitors, and Preliminary Biology Insight. J Med Chem59:4711-23 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Maternal embryonic leucine zipper kinase
Name:Maternal embryonic leucine zipper kinase
Synonyms:MELK | Maternal embryonic leucine zipper kinase
Type:Enzyme
Mol. Mass.:74665.45
Organism:Homo sapiens (Human)
Description:Q14680
Residue:651
Sequence:
MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEA
LKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAV
AYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELI
QGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLL
QQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQT
MEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDV
TASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKL
KNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPI
KIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITV
LTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQT
QSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50185436
NameBDBM50185436
Synonyms:CHEMBL3823874
TypeSmall organic molecule
Emp. Form.C25H31N5O
Mol. Mass.417.5465
SMILESCN1CCN(CC1)c1ccc(cc1)-n1cc(cn1)-c1ccncc1OC1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a