Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUbiquitin carboxyl-terminal hydrolase 1/WD repeat-containing protein 48
LigandBDBM79172
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1612850
IC50 7000±n/a nM
Citation Korzhnev, DMHadden, MK Targeting the Translesion Synthesis Pathway for the Development of Anti-Cancer Chemotherapeutics. J Med Chem59:9321-9336 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ubiquitin carboxyl-terminal hydrolase 1/WD repeat-containing protein 48
Name:Ubiquitin carboxyl-terminal hydrolase 1/WD repeat-containing protein 48
Synonyms:KIAA1449 | UAF1 | USP1-associated factor 1 | WD repeat endosomal protein | WD repeat-containing protein 48 | WDR48 | p80
Type:PROTEIN
Mol. Mass.:76215.66
Organism:Homo sapiens (Human)
Description:ChEMBL_109642
Residue:677
Sequence:
MAAHHRQNTAGRRKVQVSYVIRDEVEKYNRNGVNALQLDPALNRLFTAGRDSIIRIWSVN
QHKQDPYIASMEHHTDWVNDIVLCCNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYV
KALAYAKDKELVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQLG
TIIVSGSTEKVLRVWDPRTCAKLMKLKGHTDNVKALLLNRDGTQCLSGSSDGTIRLWSLG
QQRCIATYRVHDEGVWALQVNDAFTHVYSGGRDRKIYCTDLRNPDIRVLICEEKAPVLKM
ELDRSADPPPAIWVATTKSTVNKWTLKGIHNFRASGDYDNDCTNPITPLCTQPDQVIKGG
ASIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWF
SVDLKTGMLTITLDESDCFAAWVSAKDAGFSSPDGSDPKLNLGGLLLQALLEYWPRTHVN
PMDEEENEVNHVNGEQENRVQKGNGYFQVPPHTPVIFGEAGGRTLFRLLCRDSGGETESM
LLNETVPQWVIDITVDKNMPKFNKIPFYLQPHASSGAKTLKKDRLSASDMLQVRKVMEHV
YEKIINLDNESQTTSSSNNEKPGEQEKEEDIAVLAEEKIELLCQDQVLDPNMDLRTVKHF
IWKSGGDLTLHYRQKST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM79172
NameBDBM79172
Synonyms:2-[4-[(3Z)-3-[2-(trifluoromethyl)-9-thioxanthenylidene]propyl]-1-piperazinyl]ethanol;hydrochloride | 2-[4-[(3Z)-3-[2-(trifluoromethyl)thioxanthen-9-ylidene]propyl]piperazin-1-yl]ethanol;hydrochloride | 2-[4-[(3Z)-3-[2-(trifluoromethyl)thioxanthen-9-ylidene]propyl]piperazino]ethanol;hydrochloride | Fluphenthixol | MLS001332581 | SMR000875208 | cid_10140115 | cis-(Z)-Flupenthixol dihydrochloride
TypeSmall organic molecule
Emp. Form.C23H25F3N2OS
Mol. Mass.434.518
SMILESOCCN1CCN(CC\C=C2\c3ccccc3Sc3ccc(cc23)C(F)(F)F)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a