Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5'-AMP-activated protein kinase subunit gamma-1
LigandBDBM237920
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1612903
EC50>40000±n/a nM
Citation Cameron, KOKung, DWKalgutkar, ASKurumbail, RGMiller, RSalatto, CTWard, JWithka, JMBhattacharya, SKBoehm, MBorzilleri, KABrown, JACalabrese, MCaspers, NLCokorinos, EConn, ELDowling, MSEdmonds, DJEng, HFernando, DPFrisbie, RHepworth, DLandro, JMao, YRajamohan, FReyes, ARRose, CRRyder, TShavnya, ASmith, ACTu, MWolford, ACXiao, J Discovery and Preclinical Characterization of 6-Chloro-5-[4-(1-hydroxycyclobutyl)phenyl]-1H-indole-3-carboxylic Acid (PF-06409577), a Direct Activator of Adenosine Monophosphate-activated Protein Kinase (AMPK), for the Potential Treatment of Diabetic Nephropathy. J Med Chem59:8068-81 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
5'-AMP-activated protein kinase subunit gamma-1
Name:5'-AMP-activated protein kinase subunit gamma-1
Synonyms:5''''''''-AMP-activated protein kinase subunit gamma-1 | 5''''-AMP-activated protein kinase subunit gamma-1 | 5''-AMP-activated protein kinase subunit gamma-1 | AMP-activated protein kinase, gamma-1 subunit | AMPK alpha2/beta2/gamma1 | AMPK gamma-1 | AMPK gamma1 | AMPK subunit gamma-1 | AMPKg | PRKAG1
Type:n/a
Mol. Mass.:37581.44
Organism:Homo sapiens
Description:P54619
Residue:331
Sequence:
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM237920
NameBDBM237920
Synonyms:US9394285, 1
TypeSmall organic molecule
Emp. Form.C19H16ClNO3
Mol. Mass.341.788
SMILESOC(=O)c1c[nH]c2cc(Cl)c(cc12)-c1ccc(cc1)C1(O)CCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a