Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPAK1
LigandBDBM50340555
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1623177
IC50 100±n/a nM
Citation McCoull, WHennessy, EJBlades, KChuaqui, CDowling, JEFerguson, ADGoldberg, FWHowe, NJones, CRKemmitt, PDLamont, GVarnes, JGWard, RAYang, B Optimization of Highly Kinase Selective Bis-anilino Pyrimidine PAK1 Inhibitors. ACS Med Chem Lett7:1118-1123 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
PAK1
Name:PAK1
Synonyms:2.7.11.1 | Alpha-PAK | PAK-1 | Serine/threonine-protein kinase PAK 1 | p21-activated kinase 1 | p65-PAK
Type:n/a
Mol. Mass.:60640.15
Organism:Homo sapiens (Human)
Description:Q13153
Residue:545
Sequence:
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEA
TKNNH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50340555
NameBDBM50340555
Synonyms:(4-methyl-3-(methyl(2-(3-(methylsulfonyl)-5-morpholinophenylamino)pyrimidin-4-yl)amino)phenyl)methanol | CHEMBL1762546
TypeSmall organic molecule
Emp. Form.C24H29N5O4S
Mol. Mass.483.583
SMILESCN(c1ccnc(Nc2cc(cc(c2)S(C)(=O)=O)N2CCOCC2)n1)c1cc(CO)ccc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a