Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP-binding cassette sub-family G member 2
LigandBDBM50202247
Substrate/Competitorn/a
Meas. Tech.ChEBML_1623937
EC50 260±n/a nM
Citation Pires, ADRALecerf-Schmidt, FGuragossian, NPazinato, JGozzi, GJWinter, EValdameri, GVeale, ABoumendjel, ADi Pietro, APérès, B New, highly potent and non-toxic, chromone inhibitors of the human breast cancer resistance protein ABCG2. Eur J Med Chem122:291-301 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
ATP-binding cassette sub-family G member 2
Name:ATP-binding cassette sub-family G member 2
Synonyms:ABCP | ATP-Binding Cassette Transporter ABCG2 | ATP-binding cassette sub-family G member 2 | ATP-binding cassette transporter (ABCG2) | ATP-binding cassette, sub-family G, member 2 | BCRP | BCRP1 | Breast cancer resistance protein | CDw338 | MXR | Mitoxantrone resistance-associated protein | Placenta-specific ATP-binding cassette transporter | Urate exporter
Type:Multi-pass membrane protein; monomer or homodimer; disulfide-linked
Mol. Mass.:72329.48
Organism:Homo sapiens (Human)
Description:Q9UNQ0
Residue:655
Sequence:
MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN
NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50202247
n/a
NameBDBM50202247
Synonyms:CHEMBL3983563
TypeSmall organic molecule
Emp. Form.C28H23FN2O5
Mol. Mass.486.491
SMILESCOc1ccc2[nH]cc(CCNC(=O)c3cc(=O)c4c(OCc5ccc(F)cc5)cccc4o3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: