Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50204053
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1626008
Ki 239±n/a nM
Citation Rossi, DRui, MDi Giacomo, MSchepmann, DWŁnsch, BMonteleone, SLiedl, KRCollina, S Gaining in pan-affinity towards sigma 1 and sigma 2 receptors. SAR studies on arylalkylamines. Bioorg Med Chem25:11-19 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma-1 receptor
Synonyms:OPRS1 | SIGMAR1 | Sigma 1-type opioid receptor | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein
Type:Protein
Mol. Mass.:25307.17
Organism:Cavia porcellus (Guinea pig)
Description:Q60492
Residue:223
Sequence:
MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50204053
NameBDBM50204053
Synonyms:CHEMBL3951669
TypeSmall organic molecule
Emp. Form.C13H21NO
Mol. Mass.207.3119
SMILESCOc1cccc(c1)C(C)CCN(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a