Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcium release-activated calcium channel
LigandBDBM50204544
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1627486
IC50 2800±n/a nM
Citation Azimi, IFlanagan, JUStevenson, RJInserra, MVetter, IMonteith, GRDenny, WA Evaluation of known and novel inhibitors of Orai1-mediated store operated Ca Bioorg Med Chem25:440-449 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcium release-activated calcium channel
Name:Calcium release-activated calcium channel
Synonyms:CRACM1 | Calcium channel (VER) | Calcium release-activated calcium channel protein 1 | ORAI1 | Protein orai-1 | TMEM142A | Transmembrane protein 142A
Type:Protein
Mol. Mass.:32676.63
Organism:Homo sapiens (Human)
Description:Q96D31
Residue:301
Sequence:
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSY
SEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLL
IAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFST
VIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIAST
TIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY
A
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50204544
NameBDBM50204544
Synonyms:CHEMBL262766
TypeSmall organic molecule
Emp. Form.C15H9F6N5OS
Mol. Mass.421.32
SMILESCc1nnsc1C(=O)Nc1ccc(cc1)-n1nc(cc1C(F)(F)F)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a