Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-galactosidase A
LigandBDBM50204610
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1627785
pH7±n/a
IC50 10600±n/a nM
Commentsextracted
Citation Cheng, WCWang, JHLi, HYLu, SJHu, JMYun, WYChiu, CHYang, WBChien, YHHwu, WL Bioevaluation of sixteen ADMDP stereoisomers toward alpha-galactosidase A: Development of a new pharmacological chaperone for the treatment of Fabry disease and potential enhancement of enzyme replacement therapy efficiency. Eur J Med Chem123:14-20 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-galactosidase A
Name:Alpha-galactosidase A
Synonyms:Alpha-D-galactosidase A | Alpha-D-galactoside galactohydrolase | INN=Agalsidase | Melibiase
Type:Protein
Mol. Mass.:48760.21
Organism:Homo sapiens (Human)
Description:n/a
Residue:429
Sequence:
MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEP
DSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQL
ANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENL
ADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIK
SILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDL
RHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIG
GPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENT
MQMSLKDLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50204610
NameBDBM50204610
Synonyms:CHEMBL3908900
TypeSmall organic molecule
Emp. Form.C6H14N2O3
Mol. Mass.162.187
SMILESNC[C@@H]1N[C@H](CO)[C@H](O)[C@@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a