Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-mannosidase
LigandBDBM50204663
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1627859
Ki 390000±n/a nM
Citation Olsen, JIPlata, GBPadrón, JMLópez, ÓBols, MFernández-Bolaños, JG Selenoureido-iminosugars: A new family of multitarget drugs. Eur J Med Chem123:155-160 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-mannosidase
Name:Alpha-mannosidase
Synonyms:Alpha-mannosidase | Alpha-mannosidase, heavy subunit | Alpha-mannosidase, light subunit | JBM | Jbalpha-man
Type:PROTEIN
Mol. Mass.:108565.93
Organism:Canavalia ensiformis
Description:ChEMBL_109557
Residue:959
Sequence:
MKYNTGAGTVPEQLNVHLVPHSHDDVGWLKTVDQYYVGSENYIQEACVENVLDSVVMSLQ
RDPNRKFVFGEMAFFHRWWLEQTPETKELKLVKAGQLEFVNGGWCMHDEATTHYIDMIDH
TTLGHRFLQEQFNKIPRAGWQIDPFGHSAVQGYLLGAELGFDSVHFARIDYQDREKRKGE
KSLEVVWRGSKTFGSSAQIFANAFPGHYGPPNGFNFEVRNNFVPLQDDPRLFDTNVEERV
QNFLDAALTQAKLTRTNHLMWTMGDDFQYQYAESWFKQMDKLLHHVNKDGRVNALYSTPS
LYTEAKNAANQTWPLKIDDYFPYADGRNAYWTGFYTSRMLSGYYLATRHSGFFAGKKSTK
YHAFDLADALGIAQHHDAVSGTAKQHTTNDYAKRLALGASKAEAVVSSSLACLTSKQSAD
QCSAPASAFSQCHLFNISYCPPTESSLPDDKSLVVVVYNPLGWSRNEIVRIPVNDANLVV
KDSSGNKLEVQYVEMDDVTANLRSFYVKYWSLFKASVPPLGWSTYFISEATGKGTRNALT
LSQKGETLNIGPGDLKMSFSSLTGQLKRMYNSKTGVDLPIQQNYLWYESSEGDFSDYQAS
GAYLFRPNGQPPPHTVSRSSVTRVTRGPLVDEVHQKFNSWISQVTRLYKDKDHAEIEFTI
GPIPTDDGVGKEVITRMTSTMATNKEFYTDSNGRDFLKRVRDYREDWPLEVTQPVAGNYY
PLNLGLYTKDEKSEFSVLVDRATGGASIKDGEVELMLHRRTLRDDGRGVGEPLDEQVCMN
KEYTCEGLTVRGNYYLSIHKPAGGSRWRRTTGQEIYSPMLLAFTQENMENWKSSHSTKAY
AMDPNYSLPPSVALITLEELDDGLVLLRLAHLYEPSEDAEYSTLTKVELKKLFATQKLEE
LREVSLSANQEKSEMKKMKWSVEGDNEQEPQAVRGGPVSNADFVVELGPMEIRTFLLQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50204663
NameBDBM50204663
Synonyms:CHEMBL3894489
TypeSmall organic molecule
Emp. Form.C18H28BrN3O4Se
Mol. Mass.509.3
SMILESOC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)CN1CCCCCNC(=[Se])Nc1ccc(Br)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a