Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-mannosidase
LigandBDBM18351
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1627881
Ki 270000±n/a nM
Citation Olsen, JIPlata, GBPadrón, JMLópez, ÓBols, MFernández-Bolaños, JG Selenoureido-iminosugars: A new family of multitarget drugs. Eur J Med Chem123:155-160 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alpha-mannosidase
Name:Alpha-mannosidase
Synonyms:Alpha-mannosidase | Alpha-mannosidase, heavy subunit | Alpha-mannosidase, light subunit | JBM | Jbalpha-man
Type:PROTEIN
Mol. Mass.:108565.93
Organism:Canavalia ensiformis
Description:ChEMBL_109557
Residue:959
Sequence:
MKYNTGAGTVPEQLNVHLVPHSHDDVGWLKTVDQYYVGSENYIQEACVENVLDSVVMSLQ
RDPNRKFVFGEMAFFHRWWLEQTPETKELKLVKAGQLEFVNGGWCMHDEATTHYIDMIDH
TTLGHRFLQEQFNKIPRAGWQIDPFGHSAVQGYLLGAELGFDSVHFARIDYQDREKRKGE
KSLEVVWRGSKTFGSSAQIFANAFPGHYGPPNGFNFEVRNNFVPLQDDPRLFDTNVEERV
QNFLDAALTQAKLTRTNHLMWTMGDDFQYQYAESWFKQMDKLLHHVNKDGRVNALYSTPS
LYTEAKNAANQTWPLKIDDYFPYADGRNAYWTGFYTSRMLSGYYLATRHSGFFAGKKSTK
YHAFDLADALGIAQHHDAVSGTAKQHTTNDYAKRLALGASKAEAVVSSSLACLTSKQSAD
QCSAPASAFSQCHLFNISYCPPTESSLPDDKSLVVVVYNPLGWSRNEIVRIPVNDANLVV
KDSSGNKLEVQYVEMDDVTANLRSFYVKYWSLFKASVPPLGWSTYFISEATGKGTRNALT
LSQKGETLNIGPGDLKMSFSSLTGQLKRMYNSKTGVDLPIQQNYLWYESSEGDFSDYQAS
GAYLFRPNGQPPPHTVSRSSVTRVTRGPLVDEVHQKFNSWISQVTRLYKDKDHAEIEFTI
GPIPTDDGVGKEVITRMTSTMATNKEFYTDSNGRDFLKRVRDYREDWPLEVTQPVAGNYY
PLNLGLYTKDEKSEFSVLVDRATGGASIKDGEVELMLHRRTLRDDGRGVGEPLDEQVCMN
KEYTCEGLTVRGNYYLSIHKPAGGSRWRRTTGQEIYSPMLLAFTQENMENWKSSHSTKAY
AMDPNYSLPPSVALITLEELDDGLVLLRLAHLYEPSEDAEYSTLTKVELKKLFATQKLEE
LREVSLSANQEKSEMKKMKWSVEGDNEQEPQAVRGGPVSNADFVVELGPMEIRTFLLQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18351
NameBDBM18351
Synonyms:(2R,3R,4R,5S)-2-(Hydroxymethyl)piperidine-3,4,5-triol, 10 | (2R,3R,4R,5S)-2-(hydroxymethyl)piperidine-3,4,5-triol | 1-Deoxynojirimycin | 1-deoxynojirimycin (DNJ) | CHEMBL307429 | US9181184, 1 | dNM
Typenatural product
Emp. Form.C6H13NO4
Mol. Mass.163.1717
SMILESOC[C@H]1NC[C@H](O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a