Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50211095
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1636003
Ki 0.230000±n/a nM
Citation Varano, FCatarzi, DVincenzi, FBetti, MFalsini, MRavani, ABorea, PAColotta, VVarani, K Design, Synthesis, and Pharmacological Characterization of 2-(2-Furanyl)thiazolo[5,4-d]pyrimidine-5,7-diamine Derivatives: New Highly Potent A J Med Chem59:10564-10576 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor A1/Alpha-2A adrenergic receptor
Synonyms:A1 adenosine receptor (hA1) | A1AR | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36520.92
Organism:Homo sapiens (Human)
Description:P30542
Residue:326
Sequence:
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50211095
NameBDBM50211095
Synonyms:CHEMBL3917647
TypeSmall organic molecule
Emp. Form.C17H15N5O2S
Mol. Mass.353.398
SMILESNc1nc(NCCc2cccc(O)c2)nc2sc(nc12)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a