BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 receptor
LigandBDBM50213960
Substrate/Competitorn/a
Meas. Tech.ChEBML_85064
IC50 0.510000±n/a nM
Citation  TBA Bioorg Med Chem Lett6:1795-1798 (1996)  
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40567.22
Organism:Cavia porcellus (domestic guinea pig)
Description:For the H2 receptor-binding assays, guinea pig striatum was used.
Residue:359
Sequence:
MAFNGTVPSFCMDFTVYKVTISVILIILILVTVAGNVVVCLAVGLNRRLRSLTNCFIVSL
AVTDLLLGLLVLPFSAIYQLSCKWSFSKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLITPARVAISLVFIWVISITLSFLSIHLGWNSRNETSKDNDTIVKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYFRIFKIAREQARRINHIGSWKAATIREHKATVTLAAVM
GAFIICWFPYFTVFVYRGLKGDDAVNEVFEDVVLWLGYANSALNPILYAALNRDFRTAYH
QLFCCRLASHNSHETSLRLNNSQLNRSQCQEPRWQEDKPLNLQVWSGTEVTAPQGATNR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50213960
NameBDBM50213960
Synonyms:CHEMBL49928
TypeSmall organic molecule
Emp. Form.C21H27N3O3S
Mol. Mass.401.522
SMILESC=CCNc1c(NC\C=C/COc2csc(CN3CCCCC3)c2)c(=O)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a