BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II receptor (AT-1) type-1
LigandBDBM50214851
Substrate/Competitorn/a
Meas. Tech.ChEMBL_36487
Ki 102±n/a nM
Citation  TBA Bioorg Med Chem Lett7:385-388 (1997)  
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II receptor (AT-1) type-1
Name:Angiotensin II receptor (AT-1) type-1
Synonyms:AT1B | AT3 | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | Type-1B angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:40929.44
Organism:RAT
Description:Angiotensin II AT1B 0 RAT::P29089
Residue:359
Sequence:
MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50214851
NameBDBM50214851
Synonyms:CHEMBL340518
TypeSmall organic molecule
Emp. Form.C25H20FN7OS
Mol. Mass.485.536
SMILESCCc1nn(Cc2ccc(cc2)-c2ccccc2-c2nn[nH]n2)\c(=N\C(=O)c2ccc(F)cc2)s1
Structure
n/a