Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptide N-myristoyltransferase
LigandBDBM50220566
Substrate/Competitorn/a
Meas. Tech.ChEMBL_141176
IC50 47±n/a nM
Citation Kawasaki, KMasubuchi, MMorikami, KSogabe, SAoyama, TEbiike, HNiizuma, SHayase, MFujii, TSakata, KShindoh, HShiratori, YAoki, YOhtsuka, TShimma, N Design and synthesis of novel benzofurans as a new class of antifungal agents targeting fungal N-myristoyltransferase. Part 3. Bioorg Med Chem Lett13:87-91 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peptide N-myristoyltransferase
Name:Peptide N-myristoyltransferase
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 141178
Components:This complex has 2 components.
Component 1
Name:Peptide N-myristoyltransferase 2
Synonyms:Glycylpeptide N-tetradecanoyltransferase 2 | Myristoyl-CoA:protein N-myristoyltransferase 2 | NMT 2 | Type II N-myristoyltransferase
Type:PROTEIN
Mol. Mass.:56986.61
Organism:Homo sapiens (Human)
Description:ChEMBL_1435042
Residue:498
Sequence:
MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPN
SGGTKSDSASDSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQ
FWDTQPVPKLDEVITSHGAIEPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNE
NYVEDDDNMFRFDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIPANIRIYDS
VKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPIATCRYWH
RSLNPRKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKSVRELINTYLK
QFHLAPVMDEEEVAHWFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKA
AYSFYNIHTETPLLDLMSDALILAKSKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYL
YNWRCPGTDSEKVGLVLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Peptide N-myristoyltransferase
Synonyms:N-myristoyltransferase (NMT1) | Peptide N-myristoyltransferase | Peptide N-myristoyltransferase 1
Type:Enzyme
Mol. Mass.:56814.10
Organism:Homo sapiens (Human)
Description:P30419
Residue:496
Sequence:
MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKK
QKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFW
DTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENY
VEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEK
KMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRS
LNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQF
HLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAY
SFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYN
WKCPSMGAEKVGLVLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50220566
NameBDBM50220566
Synonyms:CHEMBL172471
TypeSmall organic molecule
Emp. Form.C24H25N3O3
Mol. Mass.403.4736
SMILESCc1c(oc2cccc(OCCCNCc3cccnc3)c12)C(O)c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a