Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha adrenergic receptor (1a and 1d)
LigandBDBM50220785
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32602
Ki 2.5±n/a nM
Citation Lopez, FJArias, LChan, RClarke, DEElworthy, TRFord, APGuzman, AJaime-Figueroa, SJasper, JRMorgans, DJPadilla, FPerez-Medrano, AQuintero, CRomero, MSandoval, LSmith, SAWilliams, TJBlue, DR Synthesis, pharmacology and pharmacokinetics of 3-(4-aryl-piperazin-1-ylalkyl)-uracils as uroselective alpha1A-antagonists. Bioorg Med Chem Lett13:1873-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha adrenergic receptor (1a and 1d)
Name:Alpha adrenergic receptor (1a and 1d)
Synonyms:ADRA1A | ADRA1D | Adrenergic receptor alpha | Alpha 1D-adrenoceptor | Alpha 1D-adrenoreceptor | Alpha-1D adrenoceptor | Alpha-adrenergic receptor 1a | adrenergic Alpha1D
Type:Enzyme Catalytic Domain
Mol. Mass.:60485.82
Organism:Homo sapiens (Human)
Description:adrenergic Alpha1D ADRA1D HUMAN::P25100
Residue:572
Sequence:
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
AVSLGVPHEVAEGATCQAYELADYSNLRETDI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50220785
NameBDBM50220785
Synonyms:CHEMBL293149
TypeSmall organic molecule
Emp. Form.C19H22F4N4O3
Mol. Mass.430.3966
SMILESCc1c[nH]c(=O)n(CCN2CCN(CC2)c2ccc(F)cc2OCC(F)(F)F)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a