Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50081909
Substrate/Competitorn/a
Meas. Tech.ChEMBL_53943
Ki 295±n/a nM
Citation Li, RLDietrich, SWHansch, C Quantitative structure-selectivity relationships. Comparison of the inhibition of Escherichia coli and bovine liver dihydrofolate reductase by 5-(substituted-benzyl)-2,4-diaminopyrimidines. J Med Chem24:538-44 (1981) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:n/a
Type:Enzyme
Mol. Mass.:21603.71
Organism:Bos taurus (Cattle)
Description:P00376
Residue:187
Sequence:
MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50081909
NameBDBM50081909
Synonyms:5-(3-(benzyloxy)benzyl)pyrimidine-2,4-diamine | 5-(3-Benzyloxy-benzyl)-pyrimidine-2,4-diamine | CHEMBL274031
TypeSmall organic molecule
Emp. Form.C18H18N4O
Mol. Mass.306.3617
SMILESNc1ncc(Cc2cccc(OCc3ccccc3)c2)c(N)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a