Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50138707
Substrate/Competitorn/a
Meas. Tech.ChEMBL_54733
Ki 151±n/a nM
Citation Li, RLDietrich, SWHansch, C Quantitative structure-selectivity relationships. Comparison of the inhibition of Escherichia coli and bovine liver dihydrofolate reductase by 5-(substituted-benzyl)-2,4-diaminopyrimidines. J Med Chem24:538-44 (1981) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:Dihydrofolate reductase (F31V) | dfrA17
Type:n/a
Mol. Mass.:17532.46
Organism:Escherichia coli
Description:n/a
Residue:157
Sequence:
MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50138707
NameBDBM50138707
Synonyms:5-(4-Methoxy-benzyl)-pyrimidine-2,4-diamine | CHEMBL19023
TypeSmall organic molecule
Emp. Form.C12H14N4O
Mol. Mass.230.2658
SMILESCOc1ccc(Cc2cnc(N)nc2N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a